Angiotensin-converting enzyme2 (ACE2) Recombinant Protein

Product code: 21-1011


Shipping Info:

2000 (throughout India)
Order now and get it on next 3-4 working days* (Major Cities)

Size
Price
100 μg
15,000.00 


Bulk Order


Shipping Info:

2000 (throughout India)

Order now and get it on next 3-4 working days* (Major Cities)


Gene : ACE2
Gene ID : 59272
Uniprot ID : Q9BYF1
Alternative Name : Angiotensin-converting enzyme homolog, Angiotensin-converting enzyme-related carboxypeptidase, Metalloprotease MPROT15
Amount : 100 μg
Purification : >95% by SDS-PAGE.
Content : 0.5 mg/ml in 50 mM Tris, pH-7.4, 300 mM NaCl and 10% Glycerol
Storage condition : ACE2 Protein is shipped on ice packs. Upon arrival, Store at -20°C. Do not freeze-thaw multiple times.
AA sequence : MDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRLEHHHHHH

Angiotensin-converting enzyme2 (ACE2) Recombinant Protein

Product code: 21-1011
mg

Can't read the image? click here to refresh.