Rabbit polyclonal antibody to Bax

Product code: ABG0120

Clonality : Polyclonal
Reactivity : Rat, Mouse, Human

Shipping Info:

2000 (throughout India)
Order now and get it on next 3-4 working days* (Major Cities)

Size
Price
100 µl


Shipping Info:

2000 (throughout India)

Order now and get it on next 3-4 working days* (Major Cities)


Gene : BAX(581)
Uniprot ID : Q07812(BAX_HUMAN)
Alternative Name : Apoptosis regulator BAX; BAX; Bax-protein; BAX_HUMAN; BAXA; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2 associated X protein omega; BCL2 associated X protein transcript variant delta2; Bcl2-L-4; BCL2L4; membrane isoform alpha;
Amount : 100 µl
Immunogen Information : A synthesized peptide derived from human BAX(Accession Q07812), corresponding to amino acid residues P43-F93.
Mol.Wt.: 21kDa; 21kD(Calculated).
Specificity: Bax Antibody detects endogenous levels of total Bax.
Expression: Q07812 BAX_HUMAN: Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
Bax Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Induces the release of cytochrome c, activation of CASP3, and thereby apoptosis. Belongs to the Bcl-2 family. Homodimer. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). 8 isoforms of the human protein are produced by alternative splicing.
Purification : The antiserum was purified by peptide affinity chromatography using SulfoLinkâ„¢ Coupling Resin
Content : Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, glycerol.
Storage condition : Store at -20 °C. Stable for 12 months from date of receipt.
AA sequence : MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:200


Rabbit polyclonal antibody to Bax

Product code: ABG0120
mg

Can't read the image? click here to refresh.