IL 1 beta HEK Recombinant Protein

Product code: 32-1367


Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Size
Price
10 µg


Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Alternative Name : Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Amount : 10 µg
Source : HEK. Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.The IL-1 beta is purified by proprietary chromatographic techniques. Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Purification : Greater than 95% as obsereved by SDS-PAGE.
Content : The IL-1 beta was lyophilized from 1mg/ml in 1xPBS.
Storage condition : Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
AA sequence : APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS.

It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA. The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.


IL 1 beta HEK Recombinant Protein

Product code: 32-1367
mg

Can't read the image? click here to refresh.