IL 13 Recombinant Protein

Product code: 32-1447


Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Size
Price
10 µg


Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Alternative Name : NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Amount : 10 µg
Source : Escherichia Coli. Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques. IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.
Purification : Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Content : The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
Storage condition : Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
AA sequence : GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.

It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of >1 x 106units/mg.


IL 13 Recombinant Protein

Product code: 32-1447
mg

Can't read the image? click here to refresh.