Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)

Product code: 36-1582

Clonality : Monoclonal
Application : IHC
Reactivity : Human

Shipping Info:

2000 throughout India Order now and get it on next 3-4 weeks

Size
Price
100 µg


Shipping Info:

2000 throughout India Order now and get it on next 3-4 weeks

Gene : ANO1
Gene ID : 55107
Uniprot ID : Q5XXA6
Alternative Name : ANO1, DOG1, ORAOV2, TAOS2, TMEM16A
Format : Purified
Amount : 100 µg
Clone name : DG1/447 + DOG-1.1
Isotype : Mouse IgG1, kappa + Mouse IgG1, kappa
Immunogen Information : Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjµgated to a carrier protein (DOG-1.1).
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Purification : Affinity Chromatography
Content : 100 µg in 500 µl PBS containing 0.05% BSA and 0.05% sodium azide. Sodium azide is highly toxic.
Storage condition : Store the antibody at 4°C; stable for 6 months. For long-term storage; store at -20°C. Avoid repeated freeze and thaw cycles.

Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes);


Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)

Product code: 36-1582
mg

Can't read the image? click here to refresh.