Pramlintide Recombinant Protein

/home/aabgenex1/public_html/templates/abgenex/includes/modules/additional_images.php

Roll over image to zoom in

Product code: 32-2062

Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Download TDS / Manual MSDS

Size

Price

5 mg

Ask Quote

Quantity:

Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Download TDS / Manual MSDS


Amount :	5 mg

Source : Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2. Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.

Purification :	Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Content :	The protein was lyophilized with no additives.
Storage condition :	Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
AA sequence :	KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.

It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.