ProNGF Recombinant Protein

/home/aabgenex1/public_html/templates/abgenex/includes/modules/additional_images.php

Roll over image to zoom in

Product code: 32-1097

Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Download TDS / Manual MSDS

Size

Price

10 µg

Ask Quote

Quantity:

Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Download TDS / Manual MSDS


Alternative Name :	Human Pro-NGF, ProNGF, NGFB.
Amount :	10 µg

Source : Escherichia Coli. Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.

Purification :	Greater than 95.0% as determined by SDS-PAGE.
Content :	ProNGF was lyophilized from a 0.2µm filtered solution of 20mM PB and 250mM NaCl pH 7.2.
Storage condition :	Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
AA sequence :	MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.

It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.