TGF b 1 GST Recombinant Protein

/home/aabgenex1/public_html/templates/abgenex/includes/modules/additional_images.php

Roll over image to zoom in

Product code: 32-1766

Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Download TDS / Manual MSDS

Size

Price

10 µg

Ask Quote

Quantity:

Shipping Info:

2000 throughout India Order now and get it on next 3-4 Weeks (Major Cities)

Download TDS / Manual MSDS


Alternative Name :	Transforming growth factor beta-1, TGF-beta-1, CED, DPD1, TGFB.
Amount :	10 µg

Source : Escherichia Coli. The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag). Transforming growth factor betas (TGF Betas) mediate many cell-cell interactions that occur during embryonic development. Three TGF Betas have been identified in mammals. TGF Beta 1, TGF Beta 2 and TGF Beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule.

Purification :	Greater than 80.0% as determined by SDS-PAGE.
Content :	The protein solution (500µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced).
Storage condition :	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
AA sequence :	KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS.