Human Recombinant SOX2 protein

Product code: 21-6011

Application : ELISA, WB
Reactivity : Human

Shipping Info:

2000 (throughout India)
Order now and get it on next 3-4 working days* (Major Cities)

 
Size
Price

Available Pack Size(s)

16,000.00 


Bulk Order


Shipping Info:

2000 (throughout India)

Order now and get it on next 3-4 working days* (Major Cities)


Gene ID : L07335.1
Uniprot ID : P48431
Amount : 100 µg
Immunogen Information : SOX2 (AAH13923, 1 a.a. - 318 a.a.) recombinant protein with an N-terminal His-PTD-NLS tag.

Recombinant, 6xHis tag

Expression system : E. coli

Domains : HMG box DNA-binding domain

Molecular weight : 44 kDa

 SOX2 (SRY-related HMG-Box Gene 2) is a helix-loop helix transcription factor, which controls the expression of a number of genes involved in embryonic development. The SOX2 family of transcription factors have been shown to play key roles in mammalian development. The SOX2 factor is the one of the four original Yamanaka Factors and has been shown to be essential for pluripotency of embryonic stem cells. Along with Oct-4, Klf-4 and c-myc, it can reprogram somatic or differentiated cells into induced pluripotent stem cells (iPSCs).

            The recombinant protein is tagged with nuclear localization signal (NLS), a protein translocation domain (PTD, a poly arginine cell-penetrating peptide) and 6xHis at N-terminal region of the protein. The PTD will allow the entry of transcription factors through the plasma membrane and the NLS will allow entry of the proteins in to the nucleus to exert their biological actions.

 

Purification : Approximately 90%
Content : 100 µg purified protein at a concentration of 0.5 mg/ml
Storage condition : -20 Degree C. Stable for one year. Avoid repeated freeze-thaw
AA sequence : MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPM NAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFID EAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSM ASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPHP GLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQ QGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHMESGGGG SPGRRRRRRRRRRR

Cell culture, WB, ELISA, EMSA


Human Recombinant SOX2 protein

Product code: 21-6011
mg

Can't read the image? click here to refresh.